PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim01g096070.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARF
Protein Properties Length: 690aa    MW: 76964 Da    PI: 6.5109
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim01g096070.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.21.6e-23115215198
                         EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                         f+k+lt sd++++g +++ +k+a+e+       +   + +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF  
  Sopim01g096070.0.1 115 FCKILTASDTSTHGGFSVLRKHANEClpqldmtQ--ATPTQDLVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFL- 202
                         99**************************999543..445568************************************************. PP

                         -SSSEE..EEEEE- CS
                  B3  85 dgrsefelvvkvfr 98 
                          +++++el+v+v+r
  Sopim01g096070.0.1 203 -RDDSGELRVGVRR 215
                         .568999*****98 PP

2Auxin_resp101.88.8e-34241320183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a+ha++t++ F v+Y+Pr+  s+F+v ++k+++a+++ +svGmRf+m+fe+eds+err++Gt+vg+ d+++ +W++SkWrsLk
  Sopim01g096070.0.1 241 ASHAITTQTRFVVYYKPRT--SQFIVGLNKYLEAVSHGFSVGMRFRMRFEGEDSPERRFTGTIVGTGDISS-QWSESKWRSLK 320
                         789***************6..9**********************************************777.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.16E-39107244IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.2E-39109230IPR015300DNA-binding pseudobarrel domain
CDDcd100172.30E-19113215No hitNo description
SMARTSM010195.6E-21115217IPR003340B3 DNA binding domain
PfamPF023622.2E-21115215IPR003340B3 DNA binding domain
PROSITE profilePS5086312.167115217IPR003340B3 DNA binding domain
PfamPF065071.2E-31241320IPR010525Auxin response factor
PfamPF023093.0E-13563664IPR033389AUX/IAA domain
SuperFamilySSF542777.36E-14569650No hitNo description
PROSITE profilePS5174526.938574666IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 690 aa     Download sequence    Send to blast
MNLGMGTEDL YRDLWKACAG PLVDVPREGE RVYYFPQGHI EQLEASTNQA VNQQIPQFNL  60
ASKILCHVFH VQLLAETETD EVYAQITLHP EAEQEEPSKP DPCPPDLPKR TVHSFCKILT  120
ASDTSTHGGF SVLRKHANEC LPQLDMTQAT PTQDLVAKDL HGYEWRFKHI FRGQPRRHLL  180
TTGWSTFVTS KRLVAGDAFV FLRDDSGELR VGVRRLARQQ SPIPQSVISS QSMHLGVLAT  240
ASHAITTQTR FVVYYKPRTS QFIVGLNKYL EAVSHGFSVG MRFRMRFEGE DSPERRFTGT  300
IVGTGDISSQ WSESKWRSLK IQWDEPASMV RPDRVSPWEI EPFVASTCVD VAQPGIKSKR  360
PRPLDLPRSE IAVASAASPF WCPGSGLTLE VSHLGGITEV QSRDNQLFWS SKQSSSLSNG  420
MSNTSCRTHL SGAWQHNMLA NGSLNLLRDS IEDNKQLITR SALLDYGSPM SSRVSSGLLH  480
DQVNRGSKHV ISSACRLFGI DLRNNSNNTP SKAKEMLGPN ITSNCADEAP VVHDESEVDK  540
DQNVGHLNPS EEKKQFQLEA LPKDTQKQGP TSSRTRTKVQ MEGVCVGRAV DLTALSGYDD  600
LISELEKIFD IKGELCPRNK WEVVYTDDEG DMMLVGDDPW LEFCKMVRRI FIYSSEEVKK  660
MTPRCKLPIL SLEGEGTMPS VDSELKAEG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-169434313355Auxin response factor 1
4ldw_A1e-169434313355Auxin response factor 1
4ldw_B1e-169434313355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1358362KRPRP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2331200.0AC233120.6 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-101i8 map 1, complete sequence.
GenBankHG9755130.0HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010327139.10.0PREDICTED: auxin response factor 18
RefseqXP_010327135.10.0PREDICTED: auxin response factor 18
RefseqXP_010327133.10.0PREDICTED: auxin response factor 18
RefseqXP_010327130.10.0PREDICTED: auxin response factor 18
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLK4AZZ60.0K4AZZ6_SOLLC; Auxin response factor
STRINGSolyc01g096070.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.10.0auxin response factor 18